PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim10g078720.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 403aa    MW: 45312.1 Da    PI: 6.3149
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim10g078720.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.17.5e-32225279155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r+rWt++LH+rFve+v++LGG++kAtPk+il+lm+ +gLt+ hvkSHLQkYR 
  Sopim10g078720.0.1 225 KARIRWTQDLHDRFVECVNRLGGADKATPKAILKLMDSEGLTIFHVKSHLQKYRN 279
                         68****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.434222282IPR017930Myb domain
SuperFamilySSF466891.79E-16223279IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28223280IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-24225280IPR006447Myb domain, plants
PfamPF002493.0E-8229278IPR001005SANT/Myb domain
PfamPF143794.1E-20309356IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MSIQNYELAS DCNLEFPQMG FCFQPESSVE NGCQQQQQPN FWPSTDSSSS RTIISRIGSS  60
PSAFFATERY LGLTQYDYQD NNNSCTQLSK NLDPQTTSYT QQCGNGFSAD SSARVDTDFP  120
KISMPSFIRS QFSSSQPFGP EGLYGNPFSN LSEKERILLL KSKLFREIDS SNRQPASIPF  180
QGNQDYGVSN NTCGFNLVHI RQQSGSQPAN SFNNSGCSGG SLSSKARIRW TQDLHDRFVE  240
CVNRLGGADK ATPKAILKLM DSEGLTIFHV KSHLQKYRNA KFIPESTEGR SGKTDCPNNV  300
TQIDSKTGMQ IKEALHMQLE VQRRLHEQLE IQRKLQLRIE EQGEQLKKIF EQQQQTTRSL  360
LETRNSSISS PADQFTPHED EVFAAESFNN THFQSNISYN DM*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2445800.0AC244580.4 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-40g6 map 10, complete sequence.
GenBankHG9755220.0HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004249167.10.0PREDICTED: uncharacterized protein LOC101251632
TrEMBLK4D2B40.0K4D2B4_SOLLC; Uncharacterized protein
STRINGSolyc10g078720.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24912458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.13e-71G2-like family protein